Name | Recombinant Human HOXA13 |
---|---|
Supplier | Creative Biomart |
Catalog | HOXA13-28510TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P31271 |
Gene | HOXA13 |
Sequence | DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL |
Description | Recombinant fragment corresponding to amino acids 208-306 of Human HOXA13 with a N terminal proprietary tag; predicted MWt 36.52 kDa inclusive of tag. |
Supplier Page | Shop |