Recombinant Human HOXA13

Name Recombinant Human HOXA13
Supplier Creative Biomart
Catalog HOXA13-28510TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P31271
Gene HOXA13
Sequence DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
Description Recombinant fragment corresponding to amino acids 208-306 of Human HOXA13 with a N terminal proprietary tag; predicted MWt 36.52 kDa inclusive of tag.
Supplier Page Shop