Active rat IL7 full length protein

Name Active rat IL7 full length protein
Supplier Abcam
Catalog ab200296
Category Protein
Prices $107.00
Sizes 2 µg
Applications SDS-PAGE FA HPLC
Species Reactivities Rat
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 as determined by a cell proliferation assay using murine 2E8 cells is less than 2.0 ng/mL, corresponding to a specific activity of > 5.0 x 10 5 IU/mg.
SwissProt/Accession P13232
Gene IL7
Residue 26 to 154
Sequence DCHIKDKDGKAFGSVLMISINQLDKMTGTDSDCPNNEPNFFKKHLCDDTK EAAFLNRAARKLRQFLKMNISEEFNDHLLRVSDGTQTLVNCTSKEEKTIK EQKKNDPCFLKRLLREIKTCWNKILKGSI
Supplier Page Shop