Active rat MCP3 full length protein

• Supplier: Abcam
• Catalog: ab201410
• Category: Protein
• Prices: $107.00
• Sizes: 2 µg
• Applications: FA SDS-PAGE HPLC
• Species Reactivities: Rat
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE . >95% by HPLC analysis.
• Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using Human monocytes is in a concentration range of 10-100 ng/ml.
• SwissProt/Accession: P80098
• Gene: CCL7
• Residue: 24 to 97
• Sequence: QPDGTNSSTCCYVKKQKIPKRNLKSYRKITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTSTPKP