| Name | Recombinant Human JAG2 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | JAG2-29877TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | Q9Y219 |
| Gene | JAG2 |
| Sequence | AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF |
| Description | Recombinant fragment corresponding to amino acids 121-210 of Human Jagged 2 with a N terminal proprietary tag; predicted MWt 35.53 kDa inclusive of tag. |
| Supplier Page | Shop |