Recombinant Human KCNA3

Name Recombinant Human KCNA3
Supplier Creative Biomart
Catalog KCNA3-29890TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P22001
Gene KCNA3
Sequence VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Description Recombinant fragment of Human KCNA3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.
Supplier Page Shop