Recombinant Human LAMC1

Name Recombinant Human LAMC1
Supplier Creative Biomart
Catalog LAMC1-27945TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P11047
Gene LAMC1
Sequence MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Description Recombinant full length Human Laminin gamma 1 with N terminal proprietary tag; predicted MWt 30.29kDa inclusive of tag.
Supplier Page Shop