Recombinant Human LCN1

Name Recombinant Human LCN1
Supplier Creative Biomart
Catalog LCN1-29847TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P31025
Gene LCN1
Sequence SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
Description Recombinant fragment: SDEEIQDVSG TWYLKAMTVD REFPEMNLES VTPMTLTTLE GGNLEAKVTM LISGRCQEVK AVLEKTDEPG KYTADGGKHV AYIIRSHVKD HYIFYCE of Human LCN1 (amino acids 24-120) with N terminal proprietary tag, 36.3 kDa.
Supplier Page Shop