| Name | Recombinant Human LCN1 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | LCN1-29847TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P31025 |
| Gene | LCN1 |
| Sequence | SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE |
| Description | Recombinant fragment: SDEEIQDVSG TWYLKAMTVD REFPEMNLES VTPMTLTTLE GGNLEAKVTM LISGRCQEVK AVLEKTDEPG KYTADGGKHV AYIIRSHVKD HYIFYCE of Human LCN1 (amino acids 24-120) with N terminal proprietary tag, 36.3 kDa. |
| Supplier Page | Shop |