Recombinant Human LSP1

Name Recombinant Human LSP1
Supplier Creative Biomart
Catalog LSP1-29147TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P33241
Gene LSP1
Sequence TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
Description Recombinant fragment corresponding to amino acids 240-338 of Human LSP1 with an N terminal proprietary tag, Predicted MWt 36.52 kDa.
Supplier Page Shop