Name | Recombinant Human MYH3 |
---|---|
Supplier | Creative Biomart |
Catalog | MYH3-29215TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P11055 |
Gene | MYH3 |
Sequence | SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP |
Description | Recombinant fragment corresponding to amino acids 2-100 of Human heavy chain Myosin with an N terminal proprietary tag; Predicted MWt 36.52 kDa inclusive of tag. |
Supplier Page | Shop |