Recombinant Human MYH3

Name Recombinant Human MYH3
Supplier Creative Biomart
Catalog MYH3-29215TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P11055
Gene MYH3
Sequence SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP
Description Recombinant fragment corresponding to amino acids 2-100 of Human heavy chain Myosin with an N terminal proprietary tag; Predicted MWt 36.52 kDa inclusive of tag.
Supplier Page Shop