| Name | Recombinant Human NBR1 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | NBR1-27854TH |
| Category | Protein |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | Q14596 |
| Gene | NBR1 |
| Sequence | EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV |
| Description | Recombinant fragment of Human NBR1, amino acids 2-96: EPQVTLNVTF KNEIQSFLVS DPENTTWADI EAMVKVSFDL NTIQIKYLDE ENEEVSINSQ GEYEEALKMA VKQGNQLQMQ VHEGHHVVDE APPPV with a proprietary N-terminal tag, molecular weight 36.08 inclusive of tag |
| Supplier Page | Shop |