Recombinant Human NOS3

Name Recombinant Human NOS3
Supplier Creative Biomart
Catalog NOS3-28567TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P29474
Gene NOS3
Sequence QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
Description Recombinant fragment corresponding to amino acids 61-160 of Human eNOS with a proprietary tag; Predicted MWt 36.63 kDa including tag.
Supplier Page Shop