Recombinant Human NR4A2

Name Recombinant Human NR4A2
Supplier Creative Biomart
Catalog NR4A2-30493TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P43354
Gene NR4A2
Sequence GFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFP
Description Recombinant fragment corresponding to amino acids 71-170 of Human Nurr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop