Recombinant Human NRG4

• Supplier: Creative Biomart
• Catalog: NRG4-525H
• Category: Protein
• Species Reactivities: Human
• Nature: Recombinant
• Source: E. coli
• Purity: ≥96% by SDS-PAGE and HPLC
• Bioactivity: The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg.
• SwissProt/Accession: Q8WWG1
• Gene: NRG4
• Sequence: HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF
• Description: Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli.