Name | Recombinant Human OCLN |
---|---|
Supplier | Creative Biomart |
Catalog | OCLN-27768TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q16625 |
Gene | OCLN |
Sequence | ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT |
Description | Recombinant fragment corresponding to amino acids 423-522 of Human Occludin with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
Supplier Page | Shop |