Name | Recombinant Human ODF2 |
---|---|
Supplier | Creative Biomart |
Catalog | ODF2-27389TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q5BJF6 |
Gene | ODF2 |
Sequence | KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP* |
Description | Recombinant fragment of Human Cenexin1/ODF2 Isoform 3 with a N terminal proprietary tag: predicted molecular weight 36.52 kDa inclusive of tag. |
Supplier Page | Shop |