Recombinant Human ODF2

Name Recombinant Human ODF2
Supplier Creative Biomart
Catalog ODF2-27389TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q5BJF6
Gene ODF2
Sequence KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP*
Description Recombinant fragment of Human Cenexin1/ODF2 Isoform 3 with a N terminal proprietary tag: predicted molecular weight 36.52 kDa inclusive of tag.
Supplier Page Shop