Recombinant Human ORC1

Name Recombinant Human ORC1
Supplier Creative Biomart
Catalog ORC1-30513TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q13415
Gene ORC1
Sequence MAHYPTRLTTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Description Recombinant fragment corresponding to amino acids 1-110 of Human ORC1 with proprietary tag; Predicted MWt 37.73 kDa.
Supplier Page Shop