Recombinant Human OVGP1

Name Recombinant Human OVGP1
Supplier Creative Biomart
Catalog OVGP1-30528TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q12889
Gene OVGP1
Sequence RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
Description Recombinant fragment of Human OVGP1 with a N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag.
Supplier Page Shop