Recombinant Human PAX4

Name Recombinant Human PAX4
Supplier Creative Biomart
Catalog PAX4-29532TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O43316
Gene PAX4
Sequence RALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKW
Description Recombinant fragment corresponding to amino acids 121-217 of Human PAX4 isoform 3 with an N terminal proprietary tag; Predicted MWt 36.3 kDa.
Supplier Page Shop