| Name | Recombinant Human PCDH7 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | PCDH7-29959TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | O60245 |
| Gene | PCDH7 |
| Sequence | KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV |
| Description | Recombinant fragment: KQLLRYRLAE EGPADVRIGN VASDLGIVTG SGEVTFSLES GSEYLKIDNL TGELSTSERR IDREKLPQCQ MIFDENECFL DFEVSVIGPS QSWV of Human PCDH7 (amino acids 31-124) with N terminal proprietary tag, 35.97 kDa. |
| Supplier Page | Shop |