Recombinant Human PPP1R2

• Supplier: Creative Biomart
• Catalog: PPP1R2-31217TH
• Category: Protein
• Nature: Recombinant
• Source: Wheat germ
• Purity: Proprietary Purification
• SwissProt/Accession: P41236
• Gene: PPP1R2
• Sequence: MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL
• Description: Recombinant fragment corresponding to amino acids 1-100 of Human Protein phosphatase 1 inhibitor subunit 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa, inclusive of tag.