Recombinant Human PPP2R5C

Name Recombinant Human PPP2R5C
Supplier Creative Biomart
Catalog PPP2R5C-29538TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q13362
Gene PPP2R5C
Sequence MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Description Recombinant fragment corresponding to amino acids 1-100 of Human PPP2R5C with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop