Recombinant Human PPP2R5D

Name Recombinant Human PPP2R5D
Supplier Creative Biomart
Catalog PPP2R5D-29540TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q14738
Gene PPP2R5D
Sequence RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Description Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag.
Supplier Page Shop