Name | Recombinant Human PRELP |
---|---|
Supplier | Creative Biomart |
Catalog | PRELP-30073TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P51888 |
Gene | PRELP |
Sequence | RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP |
Description | Recombinant fragment corresponding to amino acids 281-365 of Human PRELP, with a N terminal proprietary tag; predicted MW: 34.98 kDa inclusive of tag |
Supplier Page | Shop |