Name | Recombinant Human PRPH |
---|---|
Supplier | Creative Biomart |
Catalog | PRPH-30643TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P41219 |
Gene | PRPH |
Sequence | RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY |
Description | Recombinant fragment corresponding to amino acids 374-470 of Human Peripherin with an N terminal proprietary tag; Predicted MWt 36.3 kDa inclusive of tag. |
Supplier Page | Shop |