Recombinant Human RAB24, His-tagged

Name Recombinant Human RAB24, His-tagged
Supplier Creative Biomart
Catalog RAB24-31280TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession Q969Q5
Gene RAB24
Sequence MGSSHHHHHHSSGLVPRGSHMGSHMSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH
Description Recombinant full-length Human Rab24 with a N terminal His tag; 227 amino acids with a predicted MWt 25.7 kDa including tag.
Supplier Page Shop