Name | Recombinant Human RENBP |
---|---|
Supplier | Creative Biomart |
Catalog | RENBP-30477TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P51606 |
Gene | RENBP |
Sequence | FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR |
Description | Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
Supplier Page | Shop |