| Name | Recombinant Human RHD, His-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | RHD-31323TH |
| Category | Protein |
| Nature | Recombinant |
| Source | E. coli |
| SwissProt/Accession | Q02161 |
| Gene | RHD |
| Sequence | ITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVISNIFNTDY |
| Description | Recombinant fragment: ITLFSIRLAT MSALSVLISV DAVLGKVNLA QLVVMVLVEV TALGNLRMVI SNIFNTDY, corresponding to amino acids 108-165 of human RhD fused to a His tag at N-terminal end, 13kDa. |
| Supplier Page | Shop |