Recombinant Human RNH1

Name Recombinant Human RNH1
Supplier Creative Biomart
Catalog RNH1-30985TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P13489
Gene RNH1
Sequence SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
Description Recombinant fragment of Human Ribonuclease Inhibitor with a N terminal proprietary tag: predicted molecular weight 35.75 kDa inclusive of tag.
Supplier Page Shop