Recombinant Human S100A14, His-tagged

Name Recombinant Human S100A14, His-tagged
Supplier Creative Biomart
Catalog S100A14-31062TH
Category Protein
Nature Recombinant
Source E. coli
SwissProt/Accession Q9HCY8
Gene S100A14
Sequence MKHHHHHHASMGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Description Recombinant full length Human S100 calcium binding protein A14 with N terminal His tag; 114 amino acids with tag, Predicted MWt 12.9 kDa.
Supplier Page Shop