Recombinant Human S100A2, His-tagged

Name Recombinant Human S100A2, His-tagged
Supplier Creative Biomart
Catalog S100A2-31341TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession P29034
Gene S100A2
Sequence MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Description Recombinant full length Human S100 alpha 2 with an N terminal His tag; 117 amino acids with tag, MWt 13.1 kDa.
Supplier Page Shop