Name | Recombinant Human S100A2, His-tagged |
---|---|
Supplier | Creative Biomart |
Catalog | S100A2-31341TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Purity | >90% by SDS-PAGE |
SwissProt/Accession | P29034 |
Gene | S100A2 |
Sequence | MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Description | Recombinant full length Human S100 alpha 2 with an N terminal His tag; 117 amino acids with tag, MWt 13.1 kDa. |
Supplier Page | Shop |