Recombinant Human SOD3

Name Recombinant Human SOD3
Supplier Creative Biomart
Catalog SOD3-31476TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P08294
Gene SOD3
Sequence EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
Description Recombinant fragment, corresponding to amino acids 26-125 of Human Superoxide Dismutase 3, with an N-terminal proprietary tag, predicted MWt 36.63 kDa
Supplier Page Shop