| Name | Recombinant Human TFPI2 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | TFPI2-129H |
| Category | Protein |
| Applications | WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Nicotiana benthamiana |
| Purity | > 97% by SDS-PAGE gel |
| Bioactivity | The activity of the inhibitor is expressed as the amount of trypsin inhibited per milligram of inhibitor. The ability to prevent the hydrolysis of benzoyl-L-arginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. One mg protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein. |
| SwissProt/Accession | P48307 |
| Gene | TFPI2 |
| Sequence | HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEK VPKV |
| Description | Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues |
| Supplier Page | Shop |