Recombinant Human UBL5, His-tagged

Name Recombinant Human UBL5, His-tagged
Supplier Creative Biomart
Catalog UBL5-31554TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession Q9BZL1
Gene UBL5
Sequence MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Description Recombinant full length Human UBL5 with an N terminal His tag; 93 amino acids with tag, Predicted MWt 10.7 kDa.
Supplier Page Shop