Name | Recombinant Human UBL5, His-tagged |
---|---|
Supplier | Creative Biomart |
Catalog | UBL5-31554TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Purity | >90% by SDS-PAGE |
SwissProt/Accession | Q9BZL1 |
Gene | UBL5 |
Sequence | MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
Description | Recombinant full length Human UBL5 with an N terminal His tag; 93 amino acids with tag, Predicted MWt 10.7 kDa. |
Supplier Page | Shop |