Name | Recombinant Human UCP3, His-tagged |
---|---|
Supplier | Creative Biomart |
Catalog | UCP3-30102TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | E. coli |
Purity | >90% by SDS-PAGE |
SwissProt/Accession | P55916 |
Gene | UCP3 |
Sequence | GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT |
Description | Recombinant fragment: GTLPNIMRNA IVNCAEVVTY DILKEKLLDY HLLT, corresponding to amino acids 181-214 of Human UCP3 fused to His tag, 10kDa. |
Supplier Page | Shop |