Recombinant Human UCP3, His-tagged

Name Recombinant Human UCP3, His-tagged
Supplier Creative Biomart
Catalog UCP3-30102TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession P55916
Gene UCP3
Sequence GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLT
Description Recombinant fragment: GTLPNIMRNA IVNCAEVVTY DILKEKLLDY HLLT, corresponding to amino acids 181-214 of Human UCP3 fused to His tag, 10kDa.
Supplier Page Shop