| Name | Recombinant Human HCC-4 (rHu HCC-4/CCL16) |
|---|---|
| Supplier | Bioworld Technology |
| Catalog | PR1040 |
| Category | Protein |
| Prices | $175.00, $375.00 |
| Sizes | 5 µg, 20 µg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia coli. |
| Purity | >97% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. Determined by its ability to chemoattract total human monocytes using a concentration range of 10.0 -100.0 ng/ml, corresponding to a Specific Activity of ＞1 x 104 IU/mg. |
| Endotoxin | Less than 1EU/mg of rHuHCC-4/CCL16 as determined by LAL method. |
| Gene | RBMS1 |
| Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
| Supplier Page | Shop |