Recombinant human Uncharacterized protein C4orf3

Name Recombinant human Uncharacterized protein C4orf3
Supplier Cusabio
Catalog CSB-YP823892HU CSB-BP823892HU CSB-MP823892HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source Yeast or Baculovirus or Mammalian cell
Tag/Conjugation His-SUMO-tag
SwissProt/Accession Q8WVX3
Gene C4orf3
Residue 1-44aa
Sequence MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSY
Description Partial of the full length of 1-66aa
Supplier Page Shop