Recombinant Human Cytochrome c oxidase assembly protein 1 homolog

Name Recombinant Human Cytochrome c oxidase assembly protein 1 homolog
Supplier Cusabio
Catalog CSB-YP004170HU CSB-BP004170HU CSB-MP004170HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source Yeast or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
SwissProt/Accession Q9GZY4
Gene COA1
Residue 38-146aa
Sequence QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Description Partial of the full length of 1-146aa
Supplier Page Shop