Recombinant human Forkhead box protein P1

Name Recombinant human Forkhead box protein P1
Supplier Cusabio
Catalog CSB-YP008841HU CSB-BP008841HU CSB-MP008841HU
Category Protein
Species Reactivities Human
Nature Recombinant
Source Yeast or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
SwissProt/Accession Q9H334
Gene FOXP1
Residue 1-114aa
Sequence MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
Description Partial of the full length of 1-677aa
Supplier Page Shop