Recombinant rat Vasopressin V1a receptor

Name Recombinant rat Vasopressin V1a receptor
Supplier Cusabio
Catalog CSB-EP156244r CSB-BP156244r CSB-MP156244r
Category Protein
Species Reactivities Rat
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
SwissProt/Accession P30560
Gene Avpr1a
Residue 7-52aa
Sequence SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK
Description Partial of the full length of 1-424aa
Supplier Page Shop