Recombinant human Telomerase protein component 1

Name Recombinant human Telomerase protein component 1
Supplier Cusabio
Catalog CSB-EP180494h(N) CSB-BP180494h(N) CSB-MP180494h(N)
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q99973
Gene TEP1
Residue 2-226aa
Sequence EKLHGHVSAHPDILSLENRCLAMLPDLQPLEKLHQHVSTHSDILSLKNQCLATLPDLKTMEKPHGYVSAHPDILSLENQCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLSSLKSTVSASPLFQSLQISHMTQADLYRVNNSNCLLSEPPSWRAQHFSKGLDLSTCPIALKSISATETAQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEVEDLAVKLT
Description Partial of the full length of 1-2627aa
Supplier Page Shop