Recombinant human Myelin transcription factor 1 protein

Name Recombinant human Myelin transcription factor 1 protein
Supplier Cusabio
Catalog CSB-EP160274h CSB-BP160274h CSB-MP160274h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q01538
Gene MYT1
Residue 900-1101aa
Sequence GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
Description Partial of the full length of 1-1121aa
Supplier Page Shop