Recombinant human Chromodomain-helicase-DNA-binding protein 4

Name Recombinant human Chromodomain-helicase-DNA-binding protein 4
Supplier Cusabio
Catalog CSB-EP010974h CSB-BP010974h CSB-MP010974h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation His-tag
SwissProt/Accession Q14839
Gene CHD4
Residue 1-219aa
Sequence MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
Description Partial of the full length of 1-1912aa
Supplier Page Shop