Recombinant human Claudin-3 protein

Name Recombinant human Claudin-3 protein
Supplier Cusabio
Catalog CSB-EP131144h CSB-BP131144h CSB-MP131144h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession O15551
Gene CLDN3
Residue 30-80aa
Sequence RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Description Partial of the full length of 1-220aa
Supplier Page Shop