Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein

Name Recombinant human Mitochondrial 2-oxoglutarate/malate carrier protein
Supplier Cusabio
Catalog CSB-EP021844h CSB-BP021844h CSB-MP021844h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession Q02978
Gene SLC25A11
Residue 43-82aa
Sequence DLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYT
Description Partial of the full length of 2-314aa
Supplier Page Shop