Recombinant human Dr1-associated corepressor protein

Name Recombinant human Dr1-associated corepressor protein
Supplier Cusabio
Catalog CSB-EP051444h CSB-BP051444h CSB-MP051444h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession Q14919
Gene DRAP1
Residue 4-198aa
Sequence KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEE
Description Partial of the full length of 2-205aa
Supplier Page Shop