Recombinant human Tricarboxylate transport protein, mitochondrial protein

Name Recombinant human Tricarboxylate transport protein, mitochondrial protein
Supplier Cusabio
Catalog CSB-EP049544h CSB-BP049544h CSB-MP049544h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 90%
SwissProt/Accession P53007
Gene SLC25A1
Residue 47-87aa
Sequence EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Description Partial of the full length of 14-311aa
Supplier Page Shop