Recombinant human Endoplasmic reticulum resident protein 29 protein

Name Recombinant human Endoplasmic reticulum resident protein 29 protein
Supplier Cusabio
Catalog CSB-EP053444h CSB-BP053444h CSB-MP053444h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 95%
SwissProt/Accession P30040
Gene ERP29
Residue 40-251aa
Sequence PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Description Partial of the full length of 33-261aa
Supplier Page Shop