Name | Recombinant human Cytochrome b-c1 complex subunit 8 protein |
---|---|
Supplier | Cusabio |
Catalog | CSB-EP038554h CSB-BP038554h CSB-MP038554h |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | E.coli or Baculovirus or Mammalian cell |
Tag/Conjugation | GST-tag |
Purity | 95% |
SwissProt/Accession | O14949 |
Gene | UQCRQ |
Residue | 2-78aa |
Sequence | GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY |
Description | Partial of the full length of 2-82aa |
Supplier Page | Shop |