Recombinant human 40S ribosomal protein S10 protein

Name Recombinant human 40S ribosomal protein S10 protein
Supplier Cusabio
Catalog CSB-EP025654h CSB-BP025654h CSB-MP025654h
Category Protein
Species Reactivities Human
Nature Recombinant
Source E.coli or Baculovirus or Mammalian cell
Tag/Conjugation GST-tag
Purity 95%
SwissProt/Accession P46783
Gene RPS10
Residue 4-165aa
Sequence PKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGGFGRGRGQPPQ
Description Partial of the full length of 1-165aa
Supplier Page Shop