Cow Prion protein PrP full length protein
| Name | Cow Prion protein PrP full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab753 |
| Category | Protein |
| Prices | $343.00 |
| Sizes | 100 µg |
| Applications | ELISA WB |
| Species Reactivities | Bovine |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag C-Terminus |
| SwissProt/Accession | P04156 |
| Gene | PRNP |
| Residue | 25 to 244 |
| Sequence | MKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHG GGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHV AGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVY YRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQ MCITQYQRESQAYYQRGAS |
| Supplier Page | Shop |
Product images
SDS-PAGE of 2 µ g PrPc (lane 1)
Product References
Copper deficiency in the young bovine results in dramatic decreases in brain - Copper deficiency in the young bovine results in dramatic decreases in brain
Legleiter LR, Spears JW, Liu HC. J Anim Sci. 2008 Nov;86(11):3069-78.
Decreased brain copper due to copper deficiency has no effect on bovine prion - Decreased brain copper due to copper deficiency has no effect on bovine prion
Legleiter LR, Ahola JK, Engle TE, Spears JW. Biochem Biophys Res Commun. 2007 Jan 26;352(4):884-8. Epub 2006 Dec 1.
Exposure to low dietary copper or low copper coupled with high dietary manganese - Exposure to low dietary copper or low copper coupled with high dietary manganese
Legleiter LR, Liu HC, Lloyd KE, Hansen SL, Fry RS, Spears JW. J Anim Sci. 2007 Nov;85(11):2895-903. Epub 2007 Jul 20.